{"product_id":"abcam-ab37259","title":"Abcam, ab37259, Anti-Cathepsin K antibody [3F9]","description":"\u003cp\u003eSize: 50µg\u003cbr\u003e\nAnti-Cathepsin K antibody [3F9] (ab37259) is a mouse monoclonal antibody detecting Cathepsin K in  Western Blot, Flow Cytometry, IHC-P . Suitable for  Human, Mouse . - Over 30 publications - Trusted since 2006\u003cbr\u003e\nKey facts\u003cbr\u003e\nHost species:Mouse,\u003cbr\u003e\nClonality:Monoclonal,\u003cbr\u003e\nClone number:3F9,\u003cbr\u003e\nIsotype:IgG2b,\u003cbr\u003e\nCarrier free:Yes,\u003cbr\u003e\nReacts with:Mouse, Human,\u003cbr\u003e\nApplications:Flow Cyt, WB, IHC-PSee reactivity dataSee the reactivity data table below for information on validated species and application combinations.,\u003cbr\u003e\nImmunogen:Recombinant Fragment Protein within Human CTSK aa 100 to C-terminus. The exact immunogen used to generate this antibody is proprietary information.P43235,\u003cbr\u003e\nEpitope:The monoclonal antibody ab37259 (clone 3F9) reacts with an epitope located between aa 115-329:APDSVDYRKKGYVTPNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM\u003c\/p\u003e\n\n\u003cp\u003eProduct details:\u003cbr\u003e\nWhat is this antibody validated in?\u003cbr\u003e\nAnti-Cathepsin K antibody [3F9] (ab37259) is a mouse monoclonal antibody and is validated for use in Western Blot (WB), Flow Cytometry (Flow Cyt), Immunohistochemistry (IHC-P) in Human, Mouse samples.\u003cbr\u003e\nWhat is the molecular weight of Cathepsin K?\u003cbr\u003e\nAnti-Cathepsin K [3F9] (ab37259) specifically detects a band for Cathepsin K (UniProt: P43235) at a molecular weight of 37kDa.\u003cbr\u003e\nTrusted by the scientific community\u003cbr\u003e\nAnti-Cathepsin K [3F9] (ab37259) was first used in a scientific publication in 2006 and has been cited over 30 times in peer-reviewed journals.\u003c\/p\u003e\n\n\u003cp\u003eProperties and Storage Information:\u003cbr\u003e\nForm-Liquid, Purification technique-Affinity purification Protein G, Purification notes-Purified from tissue culture supernatant., Storage buffer-Constituents: PBS, 0.58% Sodium chloride, Shipped at conditions-Blue Ice, Appropriate short-term storage conditions-+4°C, Appropriate long-term storage conditions--80°C, Aliquoting information-Upon delivery aliquot, Storage information-Avoid freeze \/ thaw cycle\u003c\/p\u003e\n\n\u003cp\u003eSupplementary Information:\u003cbr\u003e\nThis supplementary information is collated from multiple sources and compiled automatically.\u003cbr\u003e\nCathepsin K also known as CTSK is a protease enzyme that belongs to the papain family of cysteine proteases. With a molecular weight of approximately 37 kDa Cathepsin K is mainly expressed in osteoclasts which are cells involved in bone resorption. This enzyme functions by cleaving collagen a vital component of bone extracellular matrix which facilitates bone remodeling and turnover. Known for its collagenolytic activity Cathepsin K is important in processes where breakdown of collagen fibers is required.\u003cbr\u003e\nBiological function summary\u003cbr\u003e\nCathepsin K plays a significant role in bone metabolism. It operates within the osteoclasts where it degrades type I collagen and other matrix proteins essential for normal bone maintenance and repair. Cathepsin K does not function as part of a complex but acts independently in its enzymatic role. It is highly specific to substrates found in the bone matrix differentiating it from other cathepsins like cathepsin L or B that may have broader expression and role.\u003cbr\u003e\nPathways\u003cbr\u003e\nCathepsin K is an important player in the bone remodeling pathway. This pathway involves a series of coordinated actions between osteoclasts and osteoblasts to maintain bone health. Cathepsin K's activity is tightly regulated within this pathway to ensure proper bone density and structure. It is associated with other proteins such as osteopontin and matrix metalloproteinases which work together to modulate bone turnover. Within the RANK\/RANKL pathway Cathepsin K acts as a downstream effector following osteoclast activation by RANKL.\u003cbr\u003e\nCathepsin K is most notably linked to osteoporosis and pycnodysostosis. Osteoporosis arises due to excessive bone resorption where elevated Cathepsin K activity leads to weakened bone structure increasing fracture risk. Pycnodysostosis is a rare genetic disorder caused by mutations in the gene coding for Cathepsin K resulting in impaired bone resorption and abnormally dense but brittle bones. In these conditions proteins such as RANKL and osteoprotegerin also play critical roles by influencing osteoclast differentiation and activity thereby modulating Cathepsin K's effects.\u003c\/p\u003e","brand":"Abcam","offers":[{"title":"Default Title","offer_id":46855466811561,"sku":"ab37259","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/abcam-ab37259","provider":"Iright","version":"1.0","type":"link"}