{"product_id":"proteintech-10055-1-ap","title":"Proteintech, 10055-1-AP, SNAPIN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SNAPIN (10055-1-AP) by Proteintech is a Polyclonal antibody targeting SNAPIN in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n10055-1-AP targets SNAPIN in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, HEK-293 cells,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human testis tissue,  human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSnapin, a protein of relative molecular weight of 15kd, is implicated in neurotransmission by binding to SNAP-25. Snapin was enriched in neurons and exclusively located on synaptic vesicle membrane, which may be a PKA target for modulating transmitter release through the cAMP-dependent signal-transduction pathway. This anitbody can recognize the 15-18kd(Monomer) and 30-36kd(Dimer) forms of SNAPIN.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0101 Product name: Recombinant human SNAPIN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-136 aa of BC000761 Sequence: MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK Predict reactive species\nFull Name: SNAP-associated protein\nCalculated Molecular Weight: 15 kDa\nObserved Molecular Weight: 15-18 kDa\nGenBank Accession Number: BC000761\nGene Symbol: SNAPIN\nGene ID (NCBI): 23557\nRRID: AB_2192656\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95295\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868903952553,"sku":"10055-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10055-1-ap","provider":"Iright","version":"1.0","type":"link"}