{"product_id":"proteintech-10085-1-ap","title":"Proteintech, 10085-1-AP, PAFAH2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PAFAH2 (10085-1-AP) by Proteintech is a Polyclonal antibody targeting PAFAH2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n10085-1-AP targets PAFAH2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe family of platelet-activating factor-acetylhydrolase (PAF-AH) consists of enzymes which catalyze the hydrolysis of acetyl ester at the sn-2 position of PAF(Platelet-activating factor). The intracellular type II PAF-AH is a single polypeptide about a 40 kd distributed in both the cytosol and membranes of many kinds of cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0124 Product name: Recombinant human PAFAH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 165-392 aa of BC001158 Sequence: WIPFRRVEEGEKEFHVRNPQVHQRVSECLRVLKILQEVTAGQTVFNILPGGLDLMTLKGNIDMSRVAVMGHSFGGATAILALAKETQFRCAVALDAWMFPLERDFYPKARGPVFFINTEKFQTMESVNLMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMVRAMLAFLQKHLDLKEDYNQWNNLIEGIGPSLTPGAPHHLSSL Predict reactive species\nFull Name: platelet-activating factor acetylhydrolase 2, 40kDa\nCalculated Molecular Weight: 40 kDa\nObserved Molecular Weight: 44-46 kDa\nGenBank Accession Number: BC001158\nGene Symbol: PAFAH2\nGene ID (NCBI): 5051\nRRID: AB_2160055\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99487\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869420802217,"sku":"10085-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10085-1-ap","provider":"Iright","version":"1.0","type":"link"}