{"product_id":"proteintech-10101-2-ap","title":"Proteintech, 10101-2-AP, PITRM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PITRM1 (10101-2-AP) by Proteintech is a Polyclonal antibody targeting PITRM1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n10101-2-AP targets PITRM1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue,  A549 cells,  mouse testis tissue\nPositive IP detected in: A549 cells\nPositive IHC detected in: human breast cancer tissue,  human osteosarcoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:100-1:400\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPITRM1 (Presequence protease, mitochondrial) is a ATP-independent protease that degrades mitochondrial transit peptides after their cleavage.It is specific for peptides in the range of 10 to 65 residues.and able to degrade amyloid beta A4 (APP) protein when it accumulates in mitochondrion, suggesting a link with Alzheimer disease.It shows a preference for cleavage after small polar residues and before basic residues, but without any positional preference(PMID:16849325).This protein has a calculated molecular mass of 117kD and it is expressed widely.This antibody is specific to PITRM1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0150 Product name: Recombinant human PITRM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 209-508 aa of BC001150 Sequence: NGIPDSGHLYASIRAGRTLTPAGDLQETFSGMDQVRLMKRIAEMTDIKPILRKLPRIKKHLLNGDNMRCSVNATPQQMPQTEKAVEDFLRSIGRSKKERRPVRPHTVEKPVPSSSGGDAHVPHGSQVIRKLVMEPTFKPWQMKTHFLMPFPVNYVGECIRTVPYTDPDHASLKILARLMTAKFLHTEIREKGGAYGGGAKLSHNGIFTLYSYRDPNTIETLQSFGKAVDWAKSGKFTQQDIDEAKLSVFSTVDAPVAPSDKGMDHFLYGLSDEMKQAHREQLFAVSHDKLLAVSDRYLGT Predict reactive species\nFull Name: pitrilysin metallopeptidase 1\nCalculated Molecular Weight: 60 kDa, 117 kDa\nObserved Molecular Weight: 110-117 kDa\nGenBank Accession Number: BC001150\nGene Symbol: PITRM1\nGene ID (NCBI): 10531\nRRID: AB_2165145\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5JRX3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869572714665,"sku":"10101-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10101-2-ap","provider":"Iright","version":"1.0","type":"link"}