{"product_id":"proteintech-10103-1-ap","title":"Proteintech, 10103-1-AP, AKAP8L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AKAP8L (10103-1-AP) by Proteintech is a Polyclonal antibody targeting AKAP8L in WB, IF\/ICC, ELISA applications with reactivity to human samples\n10103-1-AP targets AKAP8L in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAKAP8L, also named as NAKAP, or NAKAP95, is a 646 amino acid protein, which contains two C2H2 AKAP95-type zinc fingers and belongs to the AKAP95 family. AKAP8L localizes in the nucleus matrix and is expressed in the brain cortex. AKAP8L could play a role in constitutive transport element (CTE)-mediated gene expression. AKAP8L may be involved in nuclear envelope breakdown and chromatin condensation. It also may regulate the initiation phase of DNA replication when associated with TMPO-beta.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0145 Product name: Recombinant human AKAP8L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 67-286 aa of BC000713 Sequence: HSWEMPSSDTNANTSASGSASADSVLSRINQRLDMVPHLETDMMQGGVYGSGGERYDSYESCDSRAVLSERDLYRSGYDYSELDPEMEMAYEGQYDAYRDQFRMRGNDTFGPRAQGWARDARSGRPMASGYGRMWEDPMGARGQCMSGASRLPSLFSQNIIPEYGMFQGMRGGGAFPGGSRFGFGFGNGMKQMRRTWKTWTTADFRTKKKKRKQGGSPDE Predict reactive species\nFull Name: A kinase (PRKA) anchor protein 8-like\nCalculated Molecular Weight: 72 kDa\nObserved Molecular Weight: 72 kDa\nGenBank Accession Number: BC000713\nGene Symbol: AKAP8L\nGene ID (NCBI): 26993\nRRID: AB_2258197\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9ULX6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869513207977,"sku":"10103-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10103-1-ap","provider":"Iright","version":"1.0","type":"link"}