{"product_id":"proteintech-10110-2-ap","title":"Proteintech, 10110-2-AP, PRC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PRC1 (10110-2-AP) by Proteintech is a Polyclonal antibody targeting PRC1 in WB, IHC, ELISA applications with reactivity to human samples\n10110-2-AP targets PRC1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, HEK-293 cells,  HeLa cells,  HepG2 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPRC1 is involved in cytokinesis. PRC1 is at high level during S and G2\/M and drop dramatically after cell exit mitosis and enter G1. PRC1 is located in the nucleus during interphase, and becomes associated with mitotic spindles in a highly dynamic manner during mitosis, and localizes to the cell mid-body during cytokinesis. PRC1 is a good substrate for several cyclin-dependent kinases (CDKs) in vitro and is phosphorylated in vivo at sites that are phosphorylated by CDK in vitro, suggesting that PRC1 is an in vivo CDK substrate.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0163 Product name: Recombinant human PRC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 13-175 aa of BC005140 Sequence: VCLQKALNHLREIWELIGIPEDQRLQRTEVVKKHIKELLDMMIAEEESLKERLIKSISVCQKELNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQELKLLQEQDQELCEILCMPHYDIDSASVPSLEELNQFRQHVTTLRETKASRREEFV Predict reactive species\nFull Name: protein regulator of cytokinesis 1\nCalculated Molecular Weight: 67 kDa\nObserved Molecular Weight: 67 kDa\nGenBank Accession Number: BC005140\nGene Symbol: PRC1\nGene ID (NCBI): 9055\nRRID: AB_2252888\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43663\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869735997609,"sku":"10110-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10110-2-ap","provider":"Iright","version":"1.0","type":"link"}