{"product_id":"proteintech-10115-1-ap","title":"Proteintech, 10115-1-AP, WDR77 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WDR77 (10115-1-AP) by Proteintech is a Polyclonal antibody targeting WDR77 in WB, IHC, ELISA applications with reactivity to human samples\n10115-1-AP targets WDR77 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, Jurkat cells\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWDR77, other named p44, MEP-50, is a component of the 20S PRMT5-containing methyltransferase complex, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins. Normally, WDR77 locates in the nucleus, such as in prostate epithelial cells. However, it localized to the cytoplasm in prostatic intraepithelial neoplasia and prostate cancer cells. Nuclear WDR77 mediates the growth inhibition and differentiation. WDR may involve in the biogenesis of small nuclear ribonucleoprotein particles.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0147 Product name: Recombinant human WDR77 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 92-342 aa of BC001679 Sequence: RGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVPTEPLPAPGPASVTE Predict reactive species\nFull Name: WD repeat domain 77\nCalculated Molecular Weight: 50 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC001679\nGene Symbol: WDR77\nGene ID (NCBI): 79084\nRRID: AB_2215725\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BQA1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869627666601,"sku":"10115-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10115-1-ap","provider":"Iright","version":"1.0","type":"link"}