{"product_id":"proteintech-10121-2-ap","title":"Proteintech, 10121-2-AP, ICAM2\/CD102 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ICAM2\/CD102 (10121-2-AP) by Proteintech is a Polyclonal antibody targeting ICAM2\/CD102 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n10121-2-AP targets ICAM2\/CD102 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HEK-293 cells,  mouse brain tissue,  RAW 264.7 cells\nPositive IHC detected in: human breast cancer tissue, mouse spleen tissue,  human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nICAM2 is a cell adhesion protein having important roles in cell migration, especially during inflammation when leukocytes cross the endothelium. Initially described as a receptor for lymphocyte function-associated antigen-1 (LFA1), ICAM2 may play a role in lymphocyte recirculation by blocking LFA-1-dependent cell adhesion. It mediates adhesive interactions important for antigen-specific immune response, NK-cell mediated clearance, lymphocyte recirculation, and other cellular interactions important for immune response and surveillance. ICAM2 has six N-linked glycosylation sites at amino acids (asparagines) 47, 82, 105, 153, 178 and 187.  This antibody got 55-80 kDa in western blotting maybe due to glycosylation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0165 Product name: Recombinant human ICAM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 104-275 aa of BC003097 Sequence: SNVSVYQPPRQVILTLQPTLVAVGKSFTIECRVPTVEPLDSLTLFLFRGNETLHYETFGKAAPAPQEATATFNSTADREDGHRNFSCLAVLDLMSRGGNIFHKHSAPKMLEIYEPVSDSQMVIIVTVVSVLLSLFVTSVLLCFIFGQHLRQQRMGTYGVRAAWRRLPQAFRP Predict reactive species\nFull Name: intercellular adhesion molecule 2\nCalculated Molecular Weight: 31 kDa\nObserved Molecular Weight: 55-80 kDa\nGenBank Accession Number: BC003097\nGene Symbol: ICAM2\/CD102\nGene ID (NCBI): 3384\nRRID: AB_2233415\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P13598\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868982956201,"sku":"10121-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10121-2-ap","provider":"Iright","version":"1.0","type":"link"}