{"product_id":"proteintech-10124-2-ap","title":"Proteintech, 10124-2-AP, VGLL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VGLL1 (10124-2-AP) by Proteintech is a Polyclonal antibody targeting VGLL1 in WB, IHC, ELISA applications with reactivity to human,  mouse,  rat samples\n10124-2-AP targets VGLL1 in WB, IHC, IF, IP, RIP, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, human brain tissue,  rat brain tissue,  PC-3 cells,  mouse brain tissue,  mouse spleen tissue,  rat spleen tissue\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVGLL1 is a specific coactivator for the mammalian TEFs. It can bind proteins of the TEA domain family of transcription factors. Vgll1-TEFs complex upregulates the expression of IGFBP-5, a proliferation-promoting gene, and facilitates anchorage-independent cell proliferation. The calculated molecular weight of VGLL1 is 29 kDa, and the observed molecular weight is 26-29 kDa(PMID:31816819,33087697).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0169 Product name: Recombinant human VGLL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 38-255 aa of BC000045 Sequence: SSVVDEHFSRALSNIKSPQELTPSSQSEGVMLKNDDSMSPNQWRYSSPWTKPQPEVPVTNRAANCNLHVPGPMAVNQFSPSLARRASVRPGELWHFSSLAGTSSLEPGYSHPFPARHLVPEPQPDGKREPLLSLLQQDRCLARPQESAARENGNPGQIAGSTGLLFNLPPGSVHYKKLYVSRGSASTSLPNETLSELETPGKYSLTPPNHWGHPHRYL Predict reactive species\nFull Name: vestigial like 1 (Drosophila)\nCalculated Molecular Weight: 29 kDa\nObserved Molecular Weight: 26-29 kDa\nGenBank Accession Number: BC000045\nGene Symbol: VGLL1\nGene ID (NCBI): 51442\nRRID: AB_2218174\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99990\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868975452329,"sku":"10124-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10124-2-ap","provider":"Iright","version":"1.0","type":"link"}