{"product_id":"proteintech-10128-2-ap","title":"Proteintech, 10128-2-AP, LRRC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LRRC1 (10128-2-AP) by Proteintech is a Polyclonal antibody targeting LRRC1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n10128-2-AP targets LRRC1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLRRC1 consists of 524 amino acids including 16 leucine-rich repeats and a LAP-specific domain.  It has been shown to be highly expressed in several human cancers and can participate in the malignant process of cancer cells,  such as hepatocellular carcinoma, breast cancer and non-small cell lung cancer. (PMID: 36370237, PMID: 37505155)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0175 Product name: Recombinant human LRRC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 16-266 aa of BC003193 Sequence: SIDKRHCSLVYVPEEIYRYARSLEELLLDANQLRELPEQFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNEIPEIPESISFCKALQVADFSGNPLTRLPESFPELQNLTCLSVNDISLQSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLSELPQEIGNLKNLLCLDVSENRLERLPEEISGLTSLTDLVISQNLLETIPDGIGKLK Predict reactive species\nFull Name: leucine rich repeat containing 1\nCalculated Molecular Weight: 59 kDa\nObserved Molecular Weight: 59 kDa\nGenBank Accession Number: BC003193\nGene Symbol: LRRC1\nGene ID (NCBI): 55227\nRRID: AB_2137458\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BTT6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869555544233,"sku":"10128-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10128-2-ap","provider":"Iright","version":"1.0","type":"link"}