{"product_id":"proteintech-10140-2-ap","title":"Proteintech, 10140-2-AP, PPP1CB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPP1CB (10140-2-AP) by Proteintech is a Polyclonal antibody targeting PPP1CB in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n10140-2-AP targets PPP1CB in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue,  NIH\/3T3\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human cervical cancer tissue, human ovary tumor tissue,  mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProtein phosphatase 1 (PP1) is the main eukaryotic protein serine\/threonine phosphatase that regulates an enormous variety of cellular processes including protein-protein interactions, gene transcription, cell-cycle progression and apoptosis. It is a trimeric complex composed of a regulatory subunit, a variable subunit and a catalytic subunit. The catalytic subunit of PP1 (PP1c) can interact with amount of regulatory subunits in vivo that target it to particular subcellular locations and regulate its activity towards specific substrates. PPP1CB migrated as a 37kd protein on SDS page. This antibody is specific to PPP1CB.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0183 Product name: Recombinant human PPP1CB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-183 aa of BC002697 Sequence: MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSME Predict reactive species\nFull Name: protein phosphatase 1, catalytic subunit, beta isoform\nCalculated Molecular Weight: 37 kDa\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: BC002697\nGene Symbol: PPP1CB\nGene ID (NCBI): 5500\nRRID: AB_2168272\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P62140\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868972077225,"sku":"10140-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10140-2-ap","provider":"Iright","version":"1.0","type":"link"}