{"product_id":"proteintech-10143-1-ap","title":"Proteintech, 10143-1-AP, Cytokeratin 14 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cytokeratin 14 (10143-1-AP) by Proteintech is a Polyclonal antibody targeting Cytokeratin 14 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n10143-1-AP targets Cytokeratin 14 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells,  rat skin tissue\nPositive IP detected in: A431 cells\nPositive IHC detected in: human lung cancer tissue, human breast cancer tissue,  human cervical cancer tissue,  human lung squamous cell carcinoma tissue,  human oesophagus cancer tissue,  human skin tissue,  human skin cancer tissue,  mouse skin tissue,  rat skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HaCaT cells, HeLa cells,  HepG2 cells,  mouse olfactory epithelium tissue\nPositive FC (Intra) detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:8000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKeratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 14 is a type I cytokeratin. It is usually found as a heterotetramer with keratin 5. Keratins K14 and K5 have long been considered to be biochemical markers of the stratified squamous epithelia, including epidermis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0188 Product name: Recombinant human KRT14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 262-472 aa of BC002690 Sequence: GQVGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEEWFFTKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLSMKASLENSLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN Predict reactive species\nFull Name: keratin 14\nCalculated Molecular Weight: 472 aa, 52 kDa\nObserved Molecular Weight: 47-50 kDa\nGenBank Accession Number: BC002690\nGene Symbol: Cytokeratin 14\nGene ID (NCBI): 3861\nRRID: AB_2134831\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P02533\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868829077673,"sku":"10143-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10143-1-ap","provider":"Iright","version":"1.0","type":"link"}