{"product_id":"proteintech-10144-2-ap","title":"Proteintech, 10144-2-AP, STAT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe STAT1 (10144-2-AP) by Proteintech is a Polyclonal antibody targeting STAT1 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples\n10144-2-AP targets STAT1 in WB, IHC, IF\/ICC, FC (Intra), IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HEK-293 cells,  A549 cells,  K-562 cells,  PC-3 cells\nPositive IP detected in: PC-3 cells\nPositive IHC detected in: human stomach tissue, human ovary cancer tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: IFN alpha treated HeLa cells\nPositive FC (Intra) detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWhat is the molecular weight of STAT1? Are there any isoforms of STAT1? Is STAT1 post-translationally modified?The molecular weight of STAT1 is 91 kDa for full-length STAT1α and 84 kDa for STAT1β, which is devoid of the C-terminal activation domain (PMID: 1502203). Phosphorylation of STAT1 regulates STAT1 activity. Phosphorylation of Tyr701 by Janus kinases (JAKs) triggers STAT1 homo- and hetero-dimerization with other STAT family members and also causes nuclear translocation, while phosphorylation of Ser727 is needed for full activation (PMID: 10851062). STAT1β lacks Ser727 and has therefore been considered to be inactive or acting in a dominant negative manner to STAT1α, although it has been further shown to be capable of transcription activation in vivo (PMID: 24710278).What is the subcellular localization of STAT1?STAT1 is present in the cytoplasm and in the nucleus. Translocation of STAT1 from the cytoplasm to the nucleus is required for its regulation of gene expression and is dependent on phosphorylation (see above). However, low levels of unphosphorylated STAT1, often referred to as U-STAT1, can also be found in the nucleus, where U-STAT1 regulates the stability of heterochromatin by binding to chromatin in monomeric or dimeric states (PMID: 18840523).What is the tissue expression pattern of STAT1?STAT1 is ubiquitously expressed.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat, pig, monkey, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0199 Product name: Recombinant human STAT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-230 aa of BC002704 Sequence: SQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNA Predict reactive species\nFull Name: signal transducer and activator of transcription 1, 91kDa\nCalculated Molecular Weight: 83 kDa\nObserved Molecular Weight: 83-87 kDa\nGenBank Accession Number: BC002704\nGene Symbol: STAT1\nGene ID (NCBI): 6772\nRRID: AB_2286875\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P42224\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868823015593,"sku":"10144-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10144-2-ap","provider":"Iright","version":"1.0","type":"link"}