{"product_id":"proteintech-10154-2-ap","title":"Proteintech, 10154-2-AP, Annexin A7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Annexin A7 (10154-2-AP) by Proteintech is a Polyclonal antibody targeting Annexin A7 in WB, IHC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n10154-2-AP targets Annexin A7 in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, Jurkat cells,  mouse lung tissue,  L02 cells,  mouse brain tissue,  mouse heart tissue,  HeLa cells,  RAW 264.7 cells,  rat brain tissue\nPositive IP detected in: U-87 MG cells, mouse heart tissue\nPositive IHC detected in: mouse heart tissue, human pancreas tissue,  human prostate cancer tissue,  human stomach tissue,  human stomach cancer tissue,  mouse stomach tissue,  rat stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAnnexin A7 (Anx7) belongs to a ubiquitous and relatively abundant family of Ca2+-dependent membrane-binding proteins, which are thought to be involved in multiple aspects of cell biology including membrane trafficking, mediation of cell-matrix interactions and membrane organization within cells. Anx7, migrated as a 50 kDa protein in SDS-PAGE, has been proposed to function in the fusion of vesicles, acting as a Ca++ channel and as Ca++ -activated GTPase, thus inducing Ca++ \/GTP-dependent secretory events.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0206 Product name: Recombinant human ANXA7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 236-466 aa of BC002632 Sequence: PTYYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSMCQGNRDENQSINHQMAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLRATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYAMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTLGTMIAGDTSGDYRRLLLAIVGQ Predict reactive species\nFull Name: annexin A7\nCalculated Molecular Weight: 50 kDa\nObserved Molecular Weight: 47 kDa, 51 kDa\nGenBank Accession Number: BC002632\nGene Symbol: Annexin A7\nGene ID (NCBI): 310\nRRID: AB_2227386\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P20073\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868910080169,"sku":"10154-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10154-2-ap","provider":"Iright","version":"1.0","type":"link"}