{"product_id":"proteintech-10155-1-ap","title":"Proteintech, 10155-1-AP, CDC42 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDC42 (10155-1-AP) by Proteintech is a Polyclonal antibody targeting CDC42 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n10155-1-AP targets CDC42 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells, C6 cells,  HeLa cells,  Jurkat cells,  NIH\/3T3 cells,  mouse brain tissue\nPositive IHC detected in: human pancreas cancer tissue, human pancreas tissue,  human skeletal muscle tissue,  rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCdc42, the human homologue of the cell division cycle 42 of Saccharomyces cerevisiae, belongs to the Rho\/Rac subfamily of Ras-like GTPases. It acts as molecular switches to regulate numerous cellular responses including the organization of the actin cytoskeleton, gene transcription, cell cycle progression, and membrane trafficking. The molecular weight is about 21 kd.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, chicken, bovine, hamster\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0207 Product name: Recombinant human CDC42 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-186 aa of BC002711 Sequence: MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSR Predict reactive species\nFull Name: cell division cycle 42 (GTP binding protein, 25kDa)\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC002711\nGene Symbol: CDC42\nGene ID (NCBI): 998\nRRID: AB_2078096\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P60953\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868833763497,"sku":"10155-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10155-1-ap","provider":"Iright","version":"1.0","type":"link"}