{"product_id":"proteintech-10159-2-ap","title":"Proteintech, 10159-2-AP, MYCN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MYCN (10159-2-AP) by Proteintech is a Polyclonal antibody targeting MYCN in WB, IHC, ELISA applications with reactivity to human,  mouse,  rat samples\n10159-2-AP targets MYCN in WB, IHC, IF, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue, SKOV-3 cells,  C6 cells,  mouse brain tissue,  SH-SY5Y cells,  rat brain tissue\nPositive IHC detected in: human thyroid cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMYCN, also named as BHLHE37 and NMYC, is a transcription factor. It is primarily expressed in normal developing embryos and is thought to be critical in brain and other neural development. It is often amplified in human neuroblastomas. IR34A can suppress MYCN expression, it suggest MYCN has a role in cell growth. The expression of the MCYN is upregulated in a variety of human tumors, most frequently neuroblastoma, where the level of expression appears to increase as the tumor progresses. The calculated molecuar weight of MYCN is 50 kDa, but Phosphorylated MYCN is about 65-70 kDa. MYCN exsits two isoforms and MV of  isoform is respectively 65 kDa and 45 kDa. (PMID: 19615087 )\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0193 Product name: Recombinant human MYCN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 289-464 aa of BC002712 Sequence: SNTKAVTTFTITVRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLKSVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKVVILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC Predict reactive species\nFull Name: v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian)\nCalculated Molecular Weight: 50 kDa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC002712\nGene Symbol: MYCN\nGene ID (NCBI): 4613\nRRID: AB_2266881\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P04198\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868874133673,"sku":"10159-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10159-2-ap","provider":"Iright","version":"1.0","type":"link"}