{"product_id":"proteintech-10204-2-ap","title":"Proteintech, 10204-2-AP, DUSP11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DUSP11 (10204-2-AP) by Proteintech is a Polyclonal antibody targeting DUSP11 in WB, IF\/ICC, IP, ELISA applications with reactivity to human samples\n10204-2-AP targets DUSP11 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HeLa cells,  K-562 cells\nPositive IP detected in: K-562 cells\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:700-1:2800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDUSP11, also known as PIR1, is a unique member of atypical DUSPs which could bind directly to RNA and possess RNA 5'-triphosphatase and diphosphatase activities. DUSP11 converts the 5' triphosphate of microRNA precursors to a 5' monophosphate, and regulates cellular noncoding RNAs levels. In addition to a catalysis towards RNA, more evidence showed that DUSP11 could also dephosphorylate proteins.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0276 Product name: Recombinant human DUSP11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-203 aa of BC000346 Sequence: MSQWHHPRSGWGRRRDFSGRSSAKKKGGNHIPERWKDYLPVGQRMPGTRFIAFKVPLQKSFEKKLAPEECFSPLDLFNKIREQNEELGLIIDLTYTQRYYKPEDLPETVPYLKIFTVGHQVPDDETIFKFKHAVNGFLKENKDNDKLIGVHCTHGLNRTGYLICIYLIDVEGVRPDDAIELFNRCRGHCLERQNYIEDLQNGP Predict reactive species\nFull Name: dual specificity phosphatase 11 (RNA\/RNP complex 1-interacting)\nCalculated Molecular Weight: 39 kDa\nObserved Molecular Weight: 39 kDa\nGenBank Accession Number: BC000346\nGene Symbol: DUSP11\nGene ID (NCBI): 8446\nRRID: AB_2277484\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75319\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868933312681,"sku":"10204-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10204-2-ap","provider":"Iright","version":"1.0","type":"link"}