{"product_id":"proteintech-10205-2-ap","title":"Proteintech, 10205-2-AP, PCNA Polyclonal antibody","description":"Size: 150ul\nThe PCNA (10205-2-AP) by Proteintech is a Polyclonal antibody targeting PCNA in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n10205-2-AP targets PCNA in WB, IHC, IF-P, IP, CoIP, ELISA, Cell treatment applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A431 cells,  BALB\/3T3 clone A31 cells,  HEK293 cells,  Jurkat cells,  MCF-7 cells,  PC-12 cells,  NIH\/3T3 cells,  C2C12 cells,  mouse spleen tissue,  rat spleen tissue\nPositive IP detected in: MCF-7 cells, HeLa cells\nPositive IHC detected in: human stomach cancer tissue, human breast cancer tissue,  human colon cancer tissue,  human liver cancer tissue,  human malignant melanoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse testis tissue, human breast cancer tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:1500-1:6000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProliferating Cell Nuclear Antigen, commonly known as PCNA, is a protein that acts as a processivity factor for DNA polymerase δ in eukaryotic cells. This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. PCNA induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. It has to be loaded onto DNA in order to be able to stimulate APEX2. PCNA protein is highly conserved during evolution; the deduced amino acid sequences of rat and human differ by only 4 of 261 amino acids. PCNA has been used as loading control for proliferating cells.  This antibody is a rabbit polyclonal antibody raised against an internal region of human PCNA. The calculated molecular weight of PCNA is 29 kDa, but modified PCNA is 36kDa (PMID: 1358458).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, rabbit, chicken, goat, sheep, fish, ducks, medaka embryos\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0277 Product name: Recombinant human PCNA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 8-256 aa of BC000491 Sequence: QGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIE Predict reactive species\nFull Name: proliferating cell nuclear antigen\nCalculated Molecular Weight: 29 kDa\/31 kDa\nObserved Molecular Weight: 36-38 kDa\nGenBank Accession Number: BC000491\nGene Symbol: PCNA\nGene ID (NCBI): 5111\nRRID: AB_2160330\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P12004\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868816953513,"sku":"10205-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10205-2-ap","provider":"Iright","version":"1.0","type":"link"}