{"product_id":"proteintech-10216-1-ap","title":"Proteintech, 10216-1-AP, Chemerin\/RARRES2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Chemerin\/RARRES2 (10216-1-AP) by Proteintech is a Polyclonal antibody targeting Chemerin\/RARRES2 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n10216-1-AP targets Chemerin\/RARRES2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma tissue\nPositive IHC detected in: human placenta tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nChemerin, also named as TIG2 and RARRES2, is adipocyte-secreted protein (adipokine) that regulates adipogenesis, metabolism and inflammation through activation of the chemokine-like receptor 1 (CMKLR1). Its other ligands include G protein-coupled receptor 1 (GPR1) and chemokine receptor-like 2 (CCRL2). It positively regulates adipocyte differentiation, modulates the expression of adipocyte genes involved in lipid and glucose metabolism and might play a role in angiogenesis, a process essential for the expansion of white adipose tissue. RARRES2 have both pro- and anti-inflammatory properties depending on the modality of enzymatic cleavage by different classes of proteases. The MW of Chemerin is 14-19 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0261 Product name: Recombinant human RARRES2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-163 aa of BC000069 Sequence: MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS Predict reactive species\nFull Name: retinoic acid receptor responder (tazarotene induced) 2\nCalculated Molecular Weight: 163 aa, 19 kDa\nObserved Molecular Weight: 14-19 kDa\nGenBank Accession Number: BC000069\nGene Symbol: RARRES2\nGene ID (NCBI): 5919\nRRID: AB_2269231\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99969\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868949827753,"sku":"10216-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10216-1-ap","provider":"Iright","version":"1.0","type":"link"}