{"product_id":"proteintech-10227-1-ap","title":"Proteintech, 10227-1-AP, EIF2S2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EIF2S2 (10227-1-AP) by Proteintech is a Polyclonal antibody targeting EIF2S2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n10227-1-AP targets EIF2S2 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, mouse testis tissue,  mouse liver tissue,  L02 cells,  HeLa cells,  PC-3 cells,  HepG2 cells,  rat liver tissue,  Jurkat cells,  NIH\/3T3 cells,  C6 cells\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human testis tissue,  human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, L02 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEukaryotic translation initiation factor 2 (eIF2) is composed of three subunits, eIF2 alpha, eIF2 beta (EIF2S2), and eIF2 gamma, which are present in equal molar amounts. eIF2 beta plays a central role in the maintenance of what is generally considered a rate-limiting step in mRNA translation. In the early steps of protein synthesis, eIF2 beta binds GTP and Met-tRNA and transfers Met-tRNA to the 40S ribosomal subunit. At the end of the initiation process, GTP bound to eIF2 beta is hydrolyzed to GDP and the eIF2\/GDP complex is released from the ribosome. The exchange of GDP bound to eIF2 beta for GTP is a prerequisite to binding Met-tRNA and is mediated by eIF2 beta, which recycles the eIF2 complex for another round of initiation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0269 Product name: Recombinant human EIF2S2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-210 aa of BC000461 Sequence: MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVV Predict reactive species\nFull Name: eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa\nCalculated Molecular Weight: 38 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC000461\nGene Symbol: EIF2S2\nGene ID (NCBI): 8894\nRRID: AB_2262043\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P20042\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868924367017,"sku":"10227-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10227-1-ap","provider":"Iright","version":"1.0","type":"link"}