{"product_id":"proteintech-10255-1-ap","title":"Proteintech, 10255-1-AP, HDAC3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HDAC3 (10255-1-AP) by Proteintech is a Polyclonal antibody targeting HDAC3 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n10255-1-AP targets HDAC3 in WB, IHC, IF\/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A431 cells,  HAP1 cells,  HL-60 cells,  U-251 cells,  HEK-293 cells,  HepG2 cells,  Jurkat cells,  K-562 cells,  bEnd.3 cells,  NIH\/3T3 cells,  C6 cells,  mouse testis tissue,  rat testis tissue\nPositive IP detected in: A431 cells\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWhat is the molecular weight of HDAC3? Is HDAC3 post-translationally modified?The molecular weight of HDAC3 is 49 kDa but HDAC3 can form homodimers and homotrimers in cells (PMID: 11779848). HDAC3 can be phosphorylated at S424 residue by protein kinase CK2, which regulates HDAC3 activity (PMID: 15805470).What is the subcellular localization of HDAC3?Unlike other class I HDACs, HDAC3 actively shuttles between the nucleus and cytoplasm (PMID: 11779848). Additionally, HDAC3 can be present at the plasma membrane, where it associates with c-Src (PMID: 16532030).What is the tissue expression pattern of HDAC3?Like other class I HDACs, HDAC3 is ubiquitously expressed (PMID: 9346952).What is the mechanism of HDAC3 in regulating gene expression?Unlike other histone deacetylates, it exists in a complex with two proteins - nuclear receptor co-repressor (N-CoR) and silencing mediator for retinoid and thyroid receptors (SMRT) - and therefore acts as a mediator of the repression function of unliganded nuclear hormone receptors (PMID: 10809664). N-CoR and SMRT play an active role in the recruitment of HDAC3 to binding sites as well as directly regulating HDAC3 activity. Additionally, HDAC3 targets growth-regulated genes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0396 Product name: Recombinant human HDAC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 187-395 aa of BC000614 Sequence: VMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADA Predict reactive species\nFull Name: histone deacetylase 3\nCalculated Molecular Weight: 49 kDa\nObserved Molecular Weight: 49 kDa\nGenBank Accession Number: BC000614\nGene Symbol: HDAC3\nGene ID (NCBI): 8841\nRRID: AB_2279733\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15379\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868835369129,"sku":"10255-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10255-1-ap","provider":"Iright","version":"1.0","type":"link"}