{"product_id":"proteintech-10258-1-ap","title":"Proteintech, 10258-1-AP, Testin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Testin (10258-1-AP) by Proteintech is a Polyclonal antibody targeting Testin in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse samples\n10258-1-AP targets Testin in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells,  K-562 cells,  MCF-7 cells,  mouse testis tissue\nPositive IP detected in: K-562 cells\nPositive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse heart tissue\nPositive IF\/ICC detected in: A549 cells, HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTestin (TES) is a cytoskeleton-associated protein that localizes along actin stress fibers at cell-cell contact areas and at focal adhesion plaques. It interacts with a variety of cytoskeletal proteins and gets involved in regulation of cell adhesion and migration. TES is a putative tumor suppressor and reduced expression of TES has been reported in various cancers. In addition, TES is a marker for Sertoli-Germ Cell junction and is useful to monitor the disruption of intercellular junctions in the testis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0379 Product name: Recombinant human TES protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 108-323 aa of BC001451 Sequence: TVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIYFWKNEKLYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNWHL Predict reactive species\nFull Name: testis derived transcript (3 LIM domains)\nCalculated Molecular Weight: 48 kDa\nObserved Molecular Weight: 38-48 kDa\nGenBank Accession Number: BC001451\nGene Symbol: TES\nGene ID (NCBI): 26136\nRRID: AB_2201712\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UGI8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869387083945,"sku":"10258-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10258-1-ap","provider":"Iright","version":"1.0","type":"link"}