{"product_id":"proteintech-10265-1-ap","title":"Proteintech, 10265-1-AP, Histone H3.3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nHistone H3.3 Polyclonal Antibody for WB, ELISA\n10265-1-AP targets Histone H3.3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHistones are the basic nuclear proteins responsible for the nucleosome structure of the chromosomal fiber. Five classes of histone genes have been reported, some of which are expressed only during S phase, while others are replication independent. The latter are referred to as replacement histones and are expressed in quiescent or terminally differentiated cells. H3F3B is one replacement histone [PMID: 8586426]. It constitutes the predominant form of histone H3 in non-dividing cells and is incorporated into chromatin independently of DNA synthesis. Deposited at sites of nucleosomal displacement throughout transcribed genes, suggesting that it represents an epigenetic imprint of transcriptionally active chromatin. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Thereby it has a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability [PMID: 14718166, 15776021].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0326 Product name: Recombinant human H3F3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3-136 aa of BC001124 Sequence: RTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA Predict reactive species\nFull Name: H3 histone, family 3B (H3.3B)\nCalculated Molecular Weight: 15 kDa\nObserved Molecular Weight: 17 kDa\nGenBank Accession Number: BC001124\nGene Symbol: H3F3B\nGene ID (NCBI): 3021\nRRID: AB_513398\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P84243\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887955136681,"sku":"10265-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10265-1-ap","provider":"Iright","version":"1.0","type":"link"}