{"product_id":"proteintech-10281-1-ap","title":"Proteintech, 10281-1-AP, LGALS3BP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LGALS3BP (10281-1-AP) by Proteintech is a Polyclonal antibody targeting LGALS3BP in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n10281-1-AP targets LGALS3BP in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, COLO 320 cells,  HEK-293 cells,  fetal human brain tissue,  HepG2 cells,  A549 cells,  human milk tissue,  human plasma tissue\nPositive IP detected in: HepG2 cells, HEK-293 cells\nPositive IHC detected in: human oesophagus cancer tissue, human breast cancer tissue,  human colon  cancer,  human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Galectin-3-binding protein (LGALS3BP, also known as 90K or Mac-2 BP) is a secreted glycoprotein which binds galectin-3, galectin-1, beta1 integrins, collagens and fibronectin (PMID: 8034587; 8024581; 11146440; 9501082). It has been implicated in tumor metastatic processes, as well as in other cell adhesion and immune functions. Levels of LGALS3BP have been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV) (PMID: 7698018). Western analysis suggests that LGALS3BP is found in breast milk, semen, saliva, urine, and tears, in addition to serum (PMID: 8390986 ).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, pig, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0294 Product name: Recombinant human LGALS3BP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 6-221 aa of BC002403 Sequence: LFWVWLLVAGTQGVNDGDMRLADGGATNQGRVEIFYRGQWGTVCDNLWDLTDASVVCRALGFENATQALGRAAFGQGSGPIMLDEVQCTGTEASLADCKSLGWLKSNCRHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITL Predict reactive species\nFull Name: lectin, galactoside-binding, soluble, 3 binding protein\nCalculated Molecular Weight: 585 aa, 65 kDa\nObserved Molecular Weight: 65-90 kDa\nGenBank Accession Number: BC002403\nGene Symbol: LGALS3BP\nGene ID (NCBI): 3959\nRRID: AB_2137066\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q08380\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868815839401,"sku":"10281-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10281-1-ap","provider":"Iright","version":"1.0","type":"link"}