{"product_id":"proteintech-10282-1-ap","title":"Proteintech, 10282-1-AP, AATF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AATF (10282-1-AP) by Proteintech is a Polyclonal antibody targeting AATF in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n10282-1-AP targets AATF in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, mouse brain tissue,  HepG2 cells,  HeLa cells,  NIH\/3T3 cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:750-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nApoptosis antagonizing transcription factor (AATF) is a nuclear phosphoprotein of 523 amino acids and contains an extremely acidic domain and a putative leucine zipper characteristic of transcription factors. AATF was identified on the basis of its interaction with MAP3K12\/DLK, a protein kinase known  to be involved in the induction of cell apoptosis. Overexpression of this gene interfered with MAP3K12 induced apoptosis. AATF also binds Rb and the core of pol II, and may be part of transcription regulatory complex.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0195 Product name: Recombinant human AATF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 7-212 aa of BC000591 Sequence: LALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDFLVVGSIRKLASASLLDTDKRYCGKTTSRKAWNEDHWEQTLPGSSDEEISDEEGSGDEDSEGLGLEEYDEDDLGAAEEQECGDHRESKKSRSHSAKTPGFSVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTF Predict reactive species\nFull Name: apoptosis antagonizing transcription factor\nCalculated Molecular Weight: 63 kDa\nObserved Molecular Weight: 80-95 kDa\nGenBank Accession Number: BC000591\nGene Symbol: AATF\nGene ID (NCBI): 26574\nRRID: AB_2219887\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NY61\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869629599913,"sku":"10282-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10282-1-ap","provider":"Iright","version":"1.0","type":"link"}