{"product_id":"proteintech-10287-2-ap","title":"Proteintech, 10287-2-AP, CYPC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CYPC (10287-2-AP) by Proteintech is a Polyclonal antibody targeting CYPC in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n10287-2-AP targets CYPC in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HuH-7 cells,  HEK-293 cells,  mouse heart tissue\nPositive IHC detected in: human heart tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCyclophilin C also named as peptidyl-prolyl cis-trans isomerase C(PPIC), is expressed in several bone marrow (BM) hematopoietic progenitors and in T‐cell precursors(PMID: 33864384). CYPC\/PPIC catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. Similar to other PPIases, this protein can bind immunosuppressant cyclosporin A. In addition, CYPC\/PPIC is involved in many biological processes, including mitochondrial metabolism, REDOX and inflammation, as well as related diseases and conditions, such as ischemia-reperfusion injury, AIDS and cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0209 Product name: Recombinant human CYPC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 6-212 aa of BC002678 Sequence: RLLLPLVLCVGLGALVFSSGAEGFRKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIADW Predict reactive species\nFull Name: peptidylprolyl isomerase C (cyclophilin C)\nCalculated Molecular Weight: 23 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC002678\nGene Symbol: PPIC\/CYPC\nGene ID (NCBI): 5480\nRRID: AB_2169424\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P45877\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868964966569,"sku":"10287-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10287-2-ap","provider":"Iright","version":"1.0","type":"link"}