{"product_id":"proteintech-10294-2-ap","title":"Proteintech, 10294-2-AP, CCM3\/PDCD10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCM3\/PDCD10 (10294-2-AP) by Proteintech is a Polyclonal antibody targeting CCM3\/PDCD10 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n10294-2-AP targets CCM3\/PDCD10 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, PC-3 cells,  Raji cells\nPositive IP detected in: MCF-7 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPDCD10, also named  CCM3 and TFAR15, belongs to the PDCD10 family. PDCD10 promotes cell proliferation, increases MAPK activity and modulates apoptotic pathways. PDCD10 is important for cell migration and for normal structure and assembly of the Golgi complex. PDCD10 is required for normal angiogenesis, vasculogenesis and hematopoiesis during embryonic development, moreover, defects in PDCD10 showed abnormal cardiovascular development. Catalog#10294-2-AP is a rabbit polyclonal antibody raised against the full-length PDCD10 of human origin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0348 Product name: Recombinant human PDCD10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 9-101 aa of BC002506 Sequence: KNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQ Predict reactive species\nFull Name: programmed cell death 10\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 25-30 kDa\nGenBank Accession Number: BC002506\nGene Symbol: PDCD10\nGene ID (NCBI): 11235\nRRID: AB_2162153\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BUL8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868878491817,"sku":"10294-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10294-2-ap","provider":"Iright","version":"1.0","type":"link"}