{"product_id":"proteintech-10304-1-ap","title":"Proteintech, 10304-1-AP, SNX1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SNX1 (10304-1-AP) by Proteintech is a Polyclonal antibody targeting SNX1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n10304-1-AP targets SNX1 in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells,  HepG2 cells,  Jurkat cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human breast cancer tissue,  human kidney tissue,  human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSorting nexin 1 (SNX1, synonyms: SNX1A, MGC8664, HsT17379) is a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This endosomal protein regulates the cell-surface expression of epidermal growth factor receptor. SNX1 also has a role in sorting protease-activated receptor-1 from early endosomes to lysosomes. This protein may form oligomeric complexes with family members.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0499 Product name: Recombinant human SNX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 82-287 aa of BC000357 Sequence: DQEPQDLFADATVELSLDSTQNNQKKVLAKTLISLPPQEATNSSKPQPTYEELEEEEQEDQFDLTVGITDPEKIGDGMNAYVAYKVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKEELPRAVGTQTLSGAGLLKM Predict reactive species\nFull Name: sorting nexin 1\nCalculated Molecular Weight: 59 kDa\nObserved Molecular Weight: 70-75 kDa\nGenBank Accession Number: BC000357\nGene Symbol: SNX1\nGene ID (NCBI): 6642\nRRID: AB_2192217\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13596\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868903985321,"sku":"10304-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10304-1-ap","provider":"Iright","version":"1.0","type":"link"}