{"product_id":"proteintech-10306-1-ap","title":"Proteintech, 10306-1-AP, B23\/NPM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe B23\/NPM1 (10306-1-AP) by Proteintech is a Polyclonal antibody targeting B23\/NPM1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, rat samples\n10306-1-AP targets B23\/NPM1 in WB, IHC, IF\/ICC, IP, CoIP, chIP, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, Jurkat cells,  multi-cells,  K-562 cells,  HeLa cells,  HEK-293 cells\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: human colon cancer tissue, human breast cancer tissue,  human normal colonNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:20000-1:100000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNucleophosmin (NPM1,B23) is a putative ribosome assembly factor with a high affinity for peptides containing nuclear localization signals (NLSs). The transport of proteins across the nuclear envelope is a selective, multistep process involving several cytoplasmic factors. Proteins must be recognized as import substrates, dock at the nuclear pore complex and translocate across the nuclear envelope in an ATP-dependent fashion. Several cytosolic and nuclear proteins that are central to this process have been identified. The 38 kDa nuclear protein nucleophosmin is involved in ribosomal assembly and rRNA transport. It is an abundant protein that is highly phosphorylated by Cdc2 kinase during mitosis. NPM1 can interact with multiple proteins to form complexes, so the detected molecular weight may sometimes increase.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0286 Product name: Recombinant human B23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-293 aa of BC002398 Sequence: MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKS Predict reactive species\nFull Name: nucleophosmin (nucleolar phosphoprotein B23, numatrin)\nCalculated Molecular Weight: 33 kDa\nObserved Molecular Weight: 35-40 kDa\nGenBank Accession Number: BC002398\nGene Symbol: NPM1\nGene ID (NCBI): 4869\nRRID: AB_2155163\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P06748\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868848836777,"sku":"10306-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10306-1-ap","provider":"Iright","version":"1.0","type":"link"}