{"product_id":"proteintech-10315-1-ap","title":"Proteintech, 10315-1-AP, Cathepsin H Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cathepsin H (10315-1-AP) by Proteintech is a Polyclonal antibody targeting Cathepsin H in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n10315-1-AP targets Cathepsin H in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HaCat cells,  Raji cells,  U-937 cells\nPositive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCathepsin H (CTSH, synonyms: CPSB, MGC1519, minichain) is a lysosomal cysteine proteinase important in the overall degradation of lysosomal proteins. It is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. This protein, which belongs to the peptidase C1 protein family, can act both as an aminopeptidase and as an endopeptidase. Increased expression of this gene has been correlated with malignant progression of prostate tumors.Cathepsin H is a unique member of the cysteine cathepsins that acts primarily as an aminopeptidase. Like other cysteine cathepsins, it is synthesized as an inactive precursor and activated by proteolytic removal of its propeptide. In human cells, Cathepsin H exists an autocatalytic form, proceeding from an inactive 41 kDa pro-form, through a 30 kDa intermediate form, to the 28 kDa mature form (PMID: 22704610).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0361 Product name: Recombinant human CTSH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 58-289 aa of BC002479 Sequence: FASNWRKINAHNNGNHTFKMALNQFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGPYPPSVDWRKKGNFVSPVKNQGACGSCWTFSTTGALESAIAIATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYG Predict reactive species\nFull Name: cathepsin H\nCalculated Molecular Weight: 41 kDa, 28 kDa\nObserved Molecular Weight: 28, 41 kDa\nGenBank Accession Number: BC002479\nGene Symbol: Cathepsin H\nGene ID (NCBI): 1512\nRRID: AB_2087534\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P09668\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868948320425,"sku":"10315-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10315-1-ap","provider":"Iright","version":"1.0","type":"link"}