{"product_id":"proteintech-10317-1-ap","title":"Proteintech, 10317-1-AP, CRMP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CRMP1 (10317-1-AP) by Proteintech is a Polyclonal antibody targeting CRMP1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n10317-1-AP targets CRMP1 in WB, IHC, IF\/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue, mouse brain tissue,  rat lung tissue\nPositive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCRMP1 (Collapsin response mediator protein 1) is also named as DPYSL1, ULIP3, DRP-1 and belongs to the collapsin response mediator protein family, which are a family of ﬁve cytoplasmic proteins predominantly expressed in the developing nervous system. CRMP1, the predicted 62-kDa protein and its 75-kDa isoform corresponding to its N-terminal splice variant already described for embryonic, neonatal, and adult brain of the rat are evidenced in the cortex of adult mouse (PMID:15834957). This protein is involved in invasion, and aggressiveness of prolactin pituitary tumors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0369 Product name: Recombinant human CRMP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 291-537 aa of BC000252 Sequence: WSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQS Predict reactive species\nFull Name: collapsin response mediator protein 1\nCalculated Molecular Weight: 62 kDa\nObserved Molecular Weight: 62 kDa\nGenBank Accession Number: BC000252\nGene Symbol: CRMP1\nGene ID (NCBI): 1400\nRRID: AB_2085347\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14194\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869401436329,"sku":"10317-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10317-1-ap","provider":"Iright","version":"1.0","type":"link"}