{"product_id":"proteintech-10345-1-ap","title":"Proteintech, 10345-1-AP, RNH1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RNH1 (10345-1-AP) by Proteintech is a Polyclonal antibody targeting RNH1 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n10345-1-AP targets RNH1 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293T cells,  human brain tissue,  human heart tissue,  human liver tissue,  L02 cells,  HepG2 cells,  Jurkat cells,  human placenta tissue,  NIH\/3T3 cells,  rat liver tissue\nPositive IP detected in: HEK-293T cells, mouse liver tissue,  rat liver tissue\nPositive IHC detected in: mouse liver tissue, mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells, A431 cells\nPositive FC (Intra) detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRibonuclease\/ angiogenin inhibitor (RNH, synonyms: RAI, MGC4569, MGC18200, MGC54054) is a protein that binds tightly to ribonucleases in cells and may be essential in the control of mRNA degradation and gene expression. The human RNH gene has been regionally localized to chromosome band 11p15 by in situ hybridization.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0350 Product name: Recombinant human RNH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-214 aa of BC000677 Sequence: MSLDIQSLDIQCEELSDARWAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQNCCLTGAGCGVLSSTLRTLPTLQELHLSDNLLGDAGLQLLCEGLLDPQCRLEKLQLEYCSLSAASCEPLASVLRAKPDFKELTVSNNDINEAGVHVLCQGLKDSPCQLEALKLESCGVTSD Predict reactive species\nFull Name: ribonuclease\/angiogenin inhibitor 1\nCalculated Molecular Weight: 50 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: BC000677\nGene Symbol: RNH1\nGene ID (NCBI): 6050\nRRID: AB_2269733\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P13489\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868920729769,"sku":"10345-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10345-1-ap","provider":"Iright","version":"1.0","type":"link"}