{"product_id":"proteintech-10347-1-ap","title":"Proteintech, 10347-1-AP, RAB4A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB4A (10347-1-AP) by Proteintech is a Polyclonal antibody targeting RAB4A in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n10347-1-AP targets RAB4A in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, mouse brain tissue,  rat brain tissue,  HeLa cells,  Neuro-2a cells,  PC-12 cells\nPositive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe human RAB genes share structural and biochemical properties with the Ras gene superfamily, and  RAB4 (synonym: RAB4A) is a  small GTPase belonging to this Ras superfamily. Accumulating data suggests an important role for RAB proteins either in endocytosis or in biosynthetic protein transport. The transport of newly synthesized proteins from endoplasmic reticulum to the Golgi complex and to secretory vesicles involves the movement of carrier vesicles, a process that appears to involve RAB protein function. RAB4 may also function as regulator along the receptor recycling pathway.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0357 Product name: Recombinant human RAB4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-218 aa of BC002438 Sequence: MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC Predict reactive species\nFull Name: RAB4A, member RAS oncogene family\nCalculated Molecular Weight: 24 kDa\nObserved Molecular Weight: 24-28 kDa\nGenBank Accession Number: BC002438\nGene Symbol: RAB4A\nGene ID (NCBI): 5867\nRRID: AB_2177544\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P20338\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868987445417,"sku":"10347-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10347-1-ap","provider":"Iright","version":"1.0","type":"link"}