{"product_id":"proteintech-10354-1-ap","title":"Proteintech, 10354-1-AP, GRWD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GRWD1 (10354-1-AP) by Proteintech is a Polyclonal antibody targeting GRWD1 in WB, IP, ELISA applications with reactivity to human samples\n10354-1-AP targets GRWD1 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells,  PC-3 cells,  SKOV-3 cells\nPositive IP detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWD-repeat proteins are a class of functionally divergent molecules that cooperate with other proteins to regulate cellular processes. WD-repeat proteins have been implicated in a variety of cellular functions that are mostly regulatory in nature, including cytoskeleton organization, vesicular fusion, pre-mRNA splicing, and cell cycle regulation. WD-repeat-containing protein designated glutamate-rich WD repeat (GRWD1) is a component of the 50S and 80S preribosomal complexes and  plays a role in ribosome biogenesis and during myeloid differentiation its levels are regulated. (PMID:15885502)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0367 Product name: Recombinant human GRWD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-236 aa of BC002440 Sequence: AESGDTSSEGPAQVYLPGRGPPLREGEELVMDEEAYVLYHRAQTGAPCLSFDIVRDHLGDNRTELPLTLYLCAGTQAESAQSNRLMMLRMHNLHGTKPPPSEGSDEEEEEEDEEDEEERKPQLELAMVPHYGGINRVRVSWLGEEPVAGVWSEKGQVEVFALRRLLQVVEEPQALAAFLRDEQAQMKPIFSFAGHMGEGFALDWSPRVTGRLLTG Predict reactive species\nFull Name: glutamate-rich WD repeat containing 1\nCalculated Molecular Weight: 49 kDa\nObserved Molecular Weight: 49 kDa\nGenBank Accession Number: BC002440\nGene Symbol: GRWD1\nGene ID (NCBI): 83743\nRRID: AB_2114642\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BQ67\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869690351785,"sku":"10354-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10354-1-ap","provider":"Iright","version":"1.0","type":"link"}