{"product_id":"proteintech-10369-1-ap","title":"Proteintech, 10369-1-AP, ErbB3\/HER3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ERBB3 (10369-1-AP) by Proteintech is a Polyclonal antibody targeting ERBB3 in IHC, ELISA applications with reactivity to human samples\n10369-1-AP targets ERBB3 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human breast cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nV-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (ErbB-3, HER3) is a member of the EGF receptor tyrosine kinase family including EGFR (HER1), Neu (ErbB-2, HER2), ErbB-3 (HER3), and ErbB-4 (HER4) that are frequently overexpressed in a variety of carcinomas.  These family members form either homodimers or heterodimers upon ligand binding to mediate cell growth. ErbB-3 binds and is activated by neuregulins and NTAK. It forms a heterodimer with each of the other ErbB receptors. ErbB-3 is predominantly expressed in epithelial tissues and brain, and is overexpressed in a subset of human mammary tumors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0215 Product name: Recombinant human ERBB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 88-331 aa of BC002706 Sequence: LVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKAF Predict reactive species\nFull Name: v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian)\nCalculated Molecular Weight: 148 kDa\nGenBank Accession Number: BC002706\nGene Symbol: ERBB3\nGene ID (NCBI): 2065\nRRID: AB_2099548\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P21860\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868924465321,"sku":"10369-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10369-1-ap","provider":"Iright","version":"1.0","type":"link"}