{"product_id":"proteintech-10420-1-ap","title":"Proteintech, 10420-1-AP, SLC25A3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC25A3 (10420-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A3 in WB, IHC, ELISA applications with reactivity to human samples\n10420-1-AP targets SLC25A3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells,  HeLa cells,  MOLT-4 cells,  PC-12 cells\nPositive IHC detected in: human lung cancer tissue, rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe mitochondrial phosphate carrier SLC25A3 belongs to the SLC25 family , which is the largest family of solute carriers. SLC25A3 encodes the phosphate carrier PiC that catalyses the import of phosphate into mitochondria where it is needed for ATP synthesis. SLC25A3 has two isoforms SLC25A3-A (a heart-type isoform) and SLC25A3-B (a liver-type isoform) as a result of alternative splicing of exon 3. It has been reported that SLC25A3 mutations are associated with mitochondrial phosphate carrier deficiency, respiratory distress and hypertrophic cardiomyopathy.  (PMID: 15984930,  27780865, 20877624)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0667 Product name: Recombinant human SLC25A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-361 aa of BC003504 Sequence: MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEYSCEFGSAKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLTQ Predict reactive species\nFull Name: solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3\nCalculated Molecular Weight: 40 kDa\nObserved Molecular Weight: 40-43 kDa\nGenBank Accession Number: BC003504\nGene Symbol: SLC25A3\nGene ID (NCBI): 5250\nRRID: AB_2877735\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q00325\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868936949929,"sku":"10420-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10420-1-ap","provider":"Iright","version":"1.0","type":"link"}