{"product_id":"proteintech-10448-1-ap","title":"Proteintech, 10448-1-AP, NOP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NOP2 (10448-1-AP) by Proteintech is a Polyclonal antibody targeting NOP2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n10448-1-AP targets NOP2 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A2780 cells,  C6 cells,  HeLa cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNOL1, (synonyms: p120, NSUN1, NOP120), is a 120 kDa proliferating-cell nucleolar antigen and  is the most cancer specific of the proliferation-associated nucleolar proteins identified thus far. NOL1 is expressed in G1 and peaks during the early S phase of the cell cycle and it has not been detected in benign tumors and most normal resting tissues. Overexpression of NOL1 caused the transformation of NIH 3T3 cells and expression of an antisense NOL1 construct inhibited the growth of NIH 3T3 cells.  NOL is localized in a novel nucleolar microfibrillar structure, and contains, consecutively, four major domains: a basic domain, an acidic domain, a hydrophobic and methionine-rich domain, and a domain rich in cysteine and proline residues. The gene for human NOL1 was assigned to chromosome 12p13 (PMID: 23775790).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0498 Product name: Recombinant human NOP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-170 aa of BC000656 Sequence: GRKLDPTKEKRGPGRKARKQKGAETELVRFLPAVSDENSKRLSSRARKRAAKRRLGSVEAPKTNKSPEAKPLPGKLPKGISAGAVQTAGKKGPQSLFNAPRGKKRPAPGSDEEEEEEDSEEDGMVNHGDLWGSEDDADTVDDYGADSNSEDEEEGEALLPIERAARKQK Predict reactive species\nFull Name: NOP2 nucleolar protein homolog (yeast)\nCalculated Molecular Weight: 120 kDa\nObserved Molecular Weight: 100-120 kDa\nGenBank Accession Number: BC000656\nGene Symbol: NOP2\nGene ID (NCBI): 4839\nRRID: AB_2282772\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P46087\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868919877801,"sku":"10448-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10448-1-ap","provider":"Iright","version":"1.0","type":"link"}