{"product_id":"proteintech-10453-1-ap","title":"Proteintech, 10453-1-AP, SLC45A2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC45A2 (10453-1-AP) by Proteintech is a Polyclonal antibody targeting SLC45A2 in IHC, ELISA applications with reactivity to human, mouse samples\n10453-1-AP targets SLC45A2 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse colon tissue, human malignant melanoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC45A2, also named as AIM1 and MATP, belongs to the glycoside-pentoside-hexuronide (GPH) cation symporter transporter (TC 2.A.2) family. It is a melanocyte differentiation antigen. SLC45A2 may transport substances required for melanin biosynthesis. (PMID:17768386,21677667)Mutation of SLC45A2 cause oculocutaneous albinism type 4 (OCA4) which is disorder of pigmentation characterized by reduced biosynthesis of melanin in the skin, hair and eyes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0699 Product name: Recombinant human SLC45A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-159 aa of BC003597 Sequence: MGSNSGQAGRHIYKSLADDGPFDSVEPPKRPTSRLIMHSMAMFGREFCYAVEAAYVTPVLLSVGLPSSLYSIVWFLSPILGFLLQPVVGSASDHCRSRWGRRRPYILTLGVMMLVGMALYLNGATVVAALIANPRRKLVWAISVTMIGVVLFDFAADFI Predict reactive species\nFull Name: solute carrier family 45, member 2\nCalculated Molecular Weight: 58 kDa\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: BC003597\nGene Symbol: SLC45A2\nGene ID (NCBI): 51151\nRRID: AB_2191075\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UMX9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869602762921,"sku":"10453-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10453-1-ap","provider":"Iright","version":"1.0","type":"link"}