{"product_id":"proteintech-10458-1-ap","title":"Proteintech, 10458-1-AP, MBP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MBP (10458-1-AP) by Proteintech is a Polyclonal antibody targeting MBP in WB, IHC, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse, rat samples\n10458-1-AP targets MBP in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\nPositive IF-Fro detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMBP belongs to the myelin basic protein family. The classic group of MBP isoforms (isoform 4-isoform 14) are the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The smaller isoforms might have an important role in remyelination of denuded axons in multiple sclerosis. The non-classic group of MBP isoforms (isoform 1-isoform 3\/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells. MBP has six isoforms.  Catalog#10458-1-AP is capable of recognizing multiple isoforms of MBP.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, rabbit\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0713 Product name: Recombinant human MBP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-171 aa of BC008749 Sequence: MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR Predict reactive species\nFull Name: myelin basic protein\nCalculated Molecular Weight: 33 kDa\nObserved Molecular Weight: 14-23 kDa\nGenBank Accession Number: BC008749\nGene Symbol: Myelin basic protein\nGene ID (NCBI): 4155\nRRID: AB_2250289\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P02686\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868825735337,"sku":"10458-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10458-1-ap","provider":"Iright","version":"1.0","type":"link"}