{"product_id":"proteintech-10477-1-ap","title":"Proteintech, 10477-1-AP, CHMP2A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHMP2A (10477-1-AP) by Proteintech is a Polyclonal antibody targeting CHMP2A in WB, IHC, ELISA applications with reactivity to human samples\n10477-1-AP targets CHMP2A in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HK-2 cells, HEK-293 cells,  HeLa cells,  HepG2 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCHMP2A, also known as Vps2-1, belongs to the chromatin-modifying protein\/charged multivesicular body protein (CHMP) family. CHMP2A is a component of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in the degradation of surface receptor proteins and the formation of endocytic multivesicular bodies (MVBs). It has been shown that CHMP2A can interact with and regulate the function of the AAA-ATPase VPS4B (PMID: 15173323). CHMP2A is also reported to be involved in HIV budding (PMID: 21396898; 23051622).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0719 Product name: Recombinant human CHMP2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-220 aa of BC002502 Sequence: MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLR Predict reactive species\nFull Name: chromatin modifying protein 2A\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC002502\nGene Symbol: CHMP2A\nGene ID (NCBI): 27243\nRRID: AB_2079470\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43633\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868840022185,"sku":"10477-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10477-1-ap","provider":"Iright","version":"1.0","type":"link"}