{"product_id":"proteintech-10489-1-ap","title":"Proteintech, 10489-1-AP, S100A14 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe S100A14 (10489-1-AP) by Proteintech is a Polyclonal antibody targeting S100A14 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, rat samples\n10489-1-AP targets S100A14 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, rat stomach tissue\nPositive IP detected in: MCF-7 cells\nPositive IHC detected in: human colon cancer tissue, human skin tissue,  human ovary tumor tissue,  human breast cancer tissue,  human bowen disease,  human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe S100 family is a multifunctional group of EF-hand type calciumbinding proteins. S100A14 protein (previously known as BCMP84, S100A15) is a recently identified member of the S100 family. It is differentially expressed in a number of different human malignancies like ovary, breast, uterus, kidney, rectum and colon cancers, and esophageal and oral squamous cell carcinomas (OSCCs).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0757 Product name: Recombinant human S100A14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-104 aa of BC005019 Sequence: MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH Predict reactive species\nFull Name: S100 calcium binding protein A14\nCalculated Molecular Weight: 12 kDa\nObserved Molecular Weight: 10-12 kDa\nGenBank Accession Number: BC005019\nGene Symbol: S100A14\nGene ID (NCBI): 57402\nRRID: AB_2183628\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HCY8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868860862633,"sku":"10489-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10489-1-ap","provider":"Iright","version":"1.0","type":"link"}