{"product_id":"proteintech-10510-1-ap","title":"Proteintech, 10510-1-AP, BLK Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BLK (10510-1-AP) by Proteintech is a Polyclonal antibody targeting BLK in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n10510-1-AP targets BLK in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, Raji cells,  SH-SY5Y cells\nPositive IP detected in: SH-SY5Y cells\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTyrosine-protein kinase Blk(BLK) is typically involved in cell proliferation and differentiation.BLK is a 58 kDa protein with important role in B-cell receptor signaling and B-cell development. BLK also stimulates INS synthesis and secretion in response to glucose and enhances the expression of several pancreatic beta-cell transcription factors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0795 Product name: Recombinant human BLK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC007371 Sequence: MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMNDRDLQMLKGEKLQVLKGTGDWWLARSL Predict reactive species\nFull Name: B lymphoid tyrosine kinase\nCalculated Molecular Weight: 58 kDa\nObserved Molecular Weight: 58 kDa\nGenBank Accession Number: BC007371\nGene Symbol: BLK\nGene ID (NCBI): 640\nRRID: AB_2274754\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P51451\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869446885545,"sku":"10510-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10510-1-ap","provider":"Iright","version":"1.0","type":"link"}