{"product_id":"proteintech-10522-1-ap","title":"Proteintech, 10522-1-AP, IFNAR2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IFNAR2 (10522-1-AP) by Proteintech is a Polyclonal antibody targeting IFNAR2 in WB, FC (Intra), ELISA applications with reactivity to human samples\n10522-1-AP targets IFNAR2 in WB, IF, FC (Intra), IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, K-562 cells,  MCF-7 cells\nPositive FC (Intra) detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0191 Product name: Recombinant human IFNAR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 230-331 aa of BC002793 Sequence: LPPGQESESAESAKIGGIITVFLIALVLTSTIVTLKWIGYICLRNSLPKVLRQGLTKGWNAVAIHRCSHNALQSETPELKQSSCLSFPSSWDYKRASLCPSD Predict reactive species\nFull Name: interferon (alpha, beta and omega) receptor 2\nCalculated Molecular Weight: 331 aa, 37 kDa\nObserved Molecular Weight: 58-70 kDa\nGenBank Accession Number: BC002793\nGene Symbol: IFNAR2\nGene ID (NCBI): 3455\nRRID: AB_10694421\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P48551\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868982988969,"sku":"10522-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10522-1-ap","provider":"Iright","version":"1.0","type":"link"}