{"product_id":"proteintech-10564-1-ap","title":"Proteintech, 10564-1-AP, APOL4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe APOL4 (10564-1-AP) by Proteintech is a Polyclonal antibody targeting APOL4 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n10564-1-AP targets APOL4 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, U-87 MG cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human liver cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0849 Product name: Recombinant human APOL4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-107 aa of BC006276 Sequence: MGSWVQLITSVGTSGLFLGVRVREEGAGMRCSKTIQAGQWLDSSKGPLGPSPPPVPTAGYSSSFCVHYVNLLPGVLVLSVTSQYPHLSMALCQLAAHDWPRLSCVCV Predict reactive species\nFull Name: apolipoprotein L, 4\nCalculated Molecular Weight: 39 kDa\nObserved Molecular Weight: 40-50 kDa\nGenBank Accession Number: BC006276\nGene Symbol: APOL4\nGene ID (NCBI): 80832\nRRID: AB_2242901\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BPW4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46884999037097,"sku":"10564-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10564-1-ap","provider":"Iright","version":"1.0","type":"link"}