{"product_id":"proteintech-10569-1-ap","title":"Proteintech, 10569-1-AP, Integrin alpha-5\/CD49e Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Integrin alpha-5\/CD49e (10569-1-AP) by Proteintech is a Polyclonal antibody targeting Integrin alpha-5\/CD49e in WB, IHC, ELISA applications with reactivity to human, mouse, monkey samples\n10569-1-AP targets Integrin alpha-5\/CD49e in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, monkey samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, 3T3-L1 cells,  COS-7 cells,  HeLa cells,  human placenta tissue,  Calu-1 cells,  NIH\/3T3 cells\nPositive IHC detected in: human placenta tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIntegrins are cell adhesion receptors that are heterodimers composed of non-covalently associated alpha and beta subunits. Integrin alpha 5 (ITGA5), belongs to the integrin alpha chain family, primarily binds to Integrin beta 1 (ITGB1) to form an α5β1 heterodimer (PMID: 33711961). Integrin α5β1 is a specific receptor of fibronectin through its arginine-glycine-aspartic acid (RGD) binding site (PMID: 19608542). Integrin α5β1 plays roles in cell adhesion, migration and matrix formation, and has emerged as an essential mediator in many human carcinomas (PMID: 33408483).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, monkey\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0860 Product name: Recombinant human Integrin alpha-5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 749-1049 aa of BC008786 Sequence: FTVPHLRDTKKTIQFDFQILSKNLNNSQSDVVSFRLSVEAQAQVTLNGVSKPEAVLFPVSDWHPRDQPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA Predict reactive species\nFull Name: integrin, alpha 5 (fibronectin receptor, alpha polypeptide)\nCalculated Molecular Weight: 115 kDa\nObserved Molecular Weight: 135-150 kDa\nGenBank Accession Number: BC008786\nGene Symbol: Integrin alpha 5\nGene ID (NCBI): 3678\nRRID: AB_2130060\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P08648\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868849131689,"sku":"10569-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10569-1-ap","provider":"Iright","version":"1.0","type":"link"}