{"product_id":"proteintech-10582-1-ap","title":"Proteintech, 10582-1-AP, PELO Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PELO (10582-1-AP) by Proteintech is a Polyclonal antibody targeting PELO in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n10582-1-AP targets PELO in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  mouse testis tissue,  SKOV-3 cells,  mouse kidney tissue,  rat kidney tissue\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human ovary cancer tissue, human liver tissue,  mouse pancreas tissue,  mouse stomach tissue,  rat ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe Pelo gene was originally identified in a mutagenesis screen for spermatogenesis-specific genes of Drosophila melanogaster. The PELO is required for the meiotic division during the G2\/M transition, and functions in recognizing stalled ribosomes and triggering endonucleolytic cleavage of the mRNA, a mechanism to release non-functional ribosomes and degrade damaged mRNAs [PMID:12556505]. It may participate in the machinery of protein synthesis or in the regulation of mRNA translation [PMID:9584085].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0873 Product name: Recombinant human PELO protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 42-384 aa of BC005889 Sequence: STIRKVQTESSTGSVGSNRVRTTLTLCVEAIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSVVLERIEQACDPAWSADVAAVVMQEGLAHICLVTPSMTLTRAKVEVNIPRKRKGNCSQHDRALERFYEQVVQAIQRHIHFDVVKCILVASPGFVREQFCDYMFQQAVKTDNKLLLENRSKFLQVHASSGHKYSLKEALCDPTVASRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPVPELSDQEGDSSSEE Predict reactive species\nFull Name: pelota homolog (Drosophila)\nCalculated Molecular Weight: 43 kDa\nObserved Molecular Weight: 43-45 kDa\nGenBank Accession Number: BC005889\nGene Symbol: PELO\nGene ID (NCBI): 53918\nRRID: AB_2236833\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BRX2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868903231657,"sku":"10582-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10582-1-ap","provider":"Iright","version":"1.0","type":"link"}