{"product_id":"proteintech-10642-1-ap","title":"Proteintech, 10642-1-AP, PGF\/PIGF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PGF\/PIGF (10642-1-AP) by Proteintech is a Polyclonal antibody targeting PGF\/PIGF in IHC, ELISA applications with reactivity to human, mouse samples\n10642-1-AP targets PGF\/PIGF in IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human placenta tissue, human breast cancer tissue,  human kidney tissue,  human meningioma tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPlacenta growth factor (PLGF) is also named as PGF and PGFL. PGF is a homodimeric glycoprotein, 46-50 kDa in size, belonging to the vascular endothelial growth factor (VEGF) sub-family. It plays an important role in pathological VEGF-driven angiogenesis. PLGF is expressed not only in placental cells but also in colon and mammary carcinomas. It acts as a primary inflammatory instigator of atherosclerotic plaque instability and thus may be useful as a risk-predicting biomarker in patients with acute coronary syndromes (ACS).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0969 Product name: Recombinant human PGF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-170 aa of BC007789 Sequence: MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR Predict reactive species\nFull Name: placental growth factor\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC007789\nGene Symbol: PGF\nGene ID (NCBI): 5228\nRRID: AB_2161061\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49763\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868855718057,"sku":"10642-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10642-1-ap","provider":"Iright","version":"1.0","type":"link"}