{"product_id":"proteintech-10656-1-ap","title":"Proteintech, 10656-1-AP, DENR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DENR (10656-1-AP) by Proteintech is a Polyclonal antibody targeting DENR in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n10656-1-AP targets DENR in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, mouse lung tissue,  HEK-293 cells,  mouse brain tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells, A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDENR, also named as SMAP-3 or DRP1, is a 198 amino acid protein, which is highly expressed in heart and skeletal muscle and moderately expressed in the brain, placenta, liver and pancreas. DENR is Up-regulated with increasing cell-density by HNRNPD and Up-regulated in ovarian and breast cancer cells by ERBB2 overexpression. The calculated molecular weight of DENR is 22 kDa, but the modified protein is about 25-30 kDa. (PMID: 27239039 )\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, pig, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1023 Product name: Recombinant human DENR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-198 aa of BC007860 Sequence: MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK Predict reactive species\nFull Name: density-regulated protein\nCalculated Molecular Weight: 27 kDa\nObserved Molecular Weight: 27-30 kDa\nGenBank Accession Number: BC007860\nGene Symbol: DENR\nGene ID (NCBI): 8562\nRRID: AB_2092124\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43583\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868901462185,"sku":"10656-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10656-1-ap","provider":"Iright","version":"1.0","type":"link"}