{"product_id":"proteintech-10657-1-ap","title":"Proteintech, 10657-1-AP, FBXW4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FBXW4 (10657-1-AP) by Proteintech is a Polyclonal antibody targeting FBXW4 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n10657-1-AP targets FBXW4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue,  mouse liver tissue\nPositive IHC detected in: human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nF-box proteins have been shown to be critical for the ubiquitin-mediated degradation of cellular regulatory proteins, and they are a family of eukaryotic proteins characterized by an approximately 40 amino acid motif. SCF complex, a class of ubiquitin ligases, consists of invariable components, Skp1 and Cullin, and variable components of F-box proteins, which have a primary role in determining substrate specificity. FBXW4, also known as SHFM3, encodes F-box and WD-40 domain-containing protein 4. Defects in SHFM3 are a cause of split-hand\/foot malformation type 3 (SHFM3), an autosomal dominant disorder characterized by hypoplasia\/aplasia of the central digits with fusion of the remaining digits.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1047 Product name: Recombinant human FBXW4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-293 aa of BC007380 Sequence: QMPWMQLEDDSLYISQANFILAYQFRPDGASLNRRPLGVFAGHDEDVCHFVLANSHIVSAGGDGKIGIHKIHSTFTVKYSAHEQEVNCVDCKGGIIVSGSRDRTAKVWPLASGRLGQCLHTIQTEDRVWSIAISPLLSSFVTGTACCGHFSPLRIWDLNSGQLMTHLGSDFPPGAGVLDVMYESPFTLLSCGYDTYVRYWDLRTSVRKCVMEWEEPHDSTLYCLQTDGNHLLATGSSYYGVVRPWDRRQRACLHAFPLTSTPLSSPVYCLRLTTKHLYAALSYNLHVLDFQNP Predict reactive species\nFull Name: F-box and WD repeat domain containing 4\nCalculated Molecular Weight: 46 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC007380\nGene Symbol: FBXW4\nGene ID (NCBI): 6468\nRRID: AB_2102754\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P57775\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887637254313,"sku":"10657-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10657-1-ap","provider":"Iright","version":"1.0","type":"link"}