{"product_id":"proteintech-10700-1-ap","title":"Proteintech, 10700-1-AP, LSM5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LSM5 (10700-1-AP) by Proteintech is a Polyclonal antibody targeting LSM5 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n10700-1-AP targets LSM5 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HL-60 cells,  human brain tissue,  human placenta tissue,  mouse ovary tissue\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1145 Product name: Recombinant human LSM5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC005938 Sequence: MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV Predict reactive species\nFull Name: LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae)\nCalculated Molecular Weight: 10 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC005938\nGene Symbol: LSM5\nGene ID (NCBI): 23658\nRRID: AB_2138475\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y4Y9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887709278377,"sku":"10700-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-10700-1-ap","provider":"Iright","version":"1.0","type":"link"}